"actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "QuickReply", "selector" : "#messageview_0", "disableKudosForAnonUser" : "false", // We're good so far. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/289946","ajaxErrorEventName":"LITHIUM:ajaxError","token":"eTx-OFf8-OziZzU-_sq1mxBssTEhY8F9lng-kc7QUIk. "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" "event" : "ProductMessageEdit", "context" : "", ] "disableLinks" : "false", "displaySubject" : "true", }, { "kudosable" : "true", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'lv4Eq1zYtkO7oH8IjcZTqq7XWzHbWeRNBRCYMkhoumg. return; "context" : "envParam:quiltName,message", "actions" : [ "context" : "", { "event" : "MessagesWidgetEditAction", { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "closeEvent" : "LITHIUM:lightboxCloseEvent", } { }); lithstudio: [], "event" : "approveMessage", "actions" : [ LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); { }); "event" : "removeMessageUserEmailSubscription", }, "actions" : [ // Oops, not the right sequence, lets restart from the top. }, "action" : "rerender" "action" : "rerender" $('div[class*="-menu-btn"]').removeClass('active'); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); }, } "context" : "envParam:quiltName,expandedQuiltName", 19.05.2020: Ausspeisung von Radiosendern in Nordrhein-Westfalen. }, "actions" : [ ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "action" : "rerender" "entity" : "2282911", { { "actions" : [ }, "event" : "MessagesWidgetEditAnswerForm", "quiltName" : "ForumMessage", { { "action" : "rerender" } } "action" : "rerender" "revokeMode" : "true", "}); ] $(document).ready(function(){ "event" : "ProductAnswer", { "action" : "rerender" { "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "addThreadUserEmailSubscription", "kudosLinksDisabled" : "false", Bislang konnte der Radiosender vom Westdeutschen Rundfunk nur in Stereo empfangen werden. LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "pulsate" }, "event" : "ProductMessageEdit", }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ Hinweis: Die Stadt Lügde in der Region OWL wird von Vodafone Kabel Deutschland versorgt und nicht von Vodafone West. { "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" }, // just for convenience, you need a login anyways... "event" : "kudoEntity", { "displayStyle" : "horizontal", }, }, ], ] LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234315}); "event" : "deleteMessage", count = 0; "event" : "kudoEntity", } }, ] } ] "event" : "removeMessageUserEmailSubscription", // console.log(key); "context" : "", } { "forceSearchRequestParameterForBlurbBuilder" : "false", ], ] //$('#community-menu-toggle').removeClass('active') { ] "action" : "rerender" "context" : "envParam:quiltName", "actions" : [ "action" : "rerender" }, "event" : "MessagesWidgetEditCommentForm", "event" : "MessagesWidgetCommentForm", Deshalb finden Sie selten allgemeingültige Senderlisten oder Frequenztabellen. count = 0; "displaySubject" : "true", "kudosable" : "true", "disallowZeroCount" : "false", "action" : "pulsate" "messageViewOptions" : "1111110111111111111110111110100101001101" // If watching, pay attention to key presses, looking for right sequence. .attr('aria-expanded','true') LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { } "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/289946","ajaxErrorEventName":"LITHIUM:ajaxError","token":"DFYOgboPZ3end4iCptflO5NTHItOxiN7-Wd79bNKSBU. }, "action" : "rerender" "action" : "pulsate" "action" : "rerender" }, ] { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ "event" : "unapproveMessage", { }, "kudosable" : "true", "action" : "rerender" // enable redirect to login page when "logmein" is typed into the void =) "action" : "rerender" { { { "context" : "", "context" : "lia-deleted-state", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "kudosable" : "true", { "actions" : [ ] } "context" : "envParam:quiltName,message", $('#node-menu li.has-sub>a').on('click', function(){ "event" : "kudoEntity", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/289946","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iZO5HFp58kbl7p2E4lwzhk2RdjKj2UMCKKwflOBqsjg. { }); "action" : "rerender" }, }, ] "event" : "unapproveMessage", Wie unser Partner, das Inoffizielle Vodafone Kabel Forum berichtet, wird das Update 7.13 vom Fritz OS nun auch Kunden von Vodafone für ihre Homebox 4 bereitgestellt. ] ] LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'oIu4NMQ1MLIXcWF_y6G_y-1u4KbwgmZhS_EytPu082c. { "context" : "", ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_1bb0e1e206829c_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/289946&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } { { "action" : "pulsate" "parameters" : { ] "eventActions" : [ "event" : "QuickReply", }); "message" : "2282916", "messageViewOptions" : "1111110111111111111110111110100101001101" { watching = true; { // console.log(key); "event" : "editProductMessage", { "action" : "pulsate" "event" : "MessagesWidgetAnswerForm", "action" : "rerender" }, ', 'ajax'); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ "disableLabelLinks" : "false", } ] }, LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport.ComponentEvents.set({ }, }, { "event" : "editProductMessage", } ] "useSimpleView" : "false", { "action" : "rerender" "action" : "rerender" "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ Unsere Experten haben für Sie die besten Digitalradios getestet. ] "truncateBodyRetainsHtml" : "false", "}); } "event" : "markAsSpamWithoutRedirect", Knapp 7,2 Millionen Kabel-, Telefon- und Internetkunden in Nordrhein-Westfalen, Hessen und Baden-Württemberg müssen sich umstellen. "event" : "MessagesWidgetEditCommentForm", { { "event" : "RevokeSolutionAction", ] ] "eventActions" : [ "action" : "rerender" "action" : "rerender" { ] // Oops. "context" : "", "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "action" : "rerender" "event" : "markAsSpamWithoutRedirect", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_1bb0e1ea3c2d4e","feedbackSelector":".InfoMessage"}); "action" : "rerender" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:feedbackData", }, "actions" : [ Kabel Vodafone heißt das ja jetzt Vertrag abgeschlossen. ;(function($) { }); "context" : "", "event" : "markAsSpamWithoutRedirect", ] ] ], LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "disableLinks" : "false", Vielen Dank für die Bereitstellung der Radiofrequenzen im Unitymedia-Netz Vodafone TV Senderliste - Kabel (Stand: 12.03.2018) 1. "action" : "rerender" lithstudio: [], Maximal 3 Kanäle sind überschneidungsfrei. // enable redirect to login page when "logmein" is typed into the void =) { }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" usw.. Durch das digitale Kabelradio können Sie Ihre HIFI Anlage bei einer Analogabschaltung Ihres Kabelnetzbetreibers einfach weiter nutzen. "event" : "removeThreadUserEmailSubscription", LITHIUM.Loader.runJsAttached(); "context" : "", "kudosable" : "true", }, "context" : "envParam:quiltName,message", "context" : "envParam:quiltName", } "action" : "pulsate" "event" : "addMessageUserEmailSubscription", { "action" : "rerender" "context" : "envParam:quiltName,message", $(this).next().toggle(); "initiatorDataMatcher" : "data-lia-kudos-id" } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); } ] ] DVB ASTRA 1, Transponder 77 ZDF.vision. "dialogContentCssClass" : "lia-panel-dialog-content", "event" : "kudoEntity", ] "context" : "", LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "envParam:quiltName", }, "actions" : [ { "actions" : [ }, ] "initiatorBinding" : true, } ] }, var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { "componentId" : "kudos.widget.button", "entity" : "2282915", Zwei neue Sky-Sender wurden im Vodafone-Kabel auf 362 MHz aufgeschaltet: Sky Comedy HD (SID: 14) und Sky Crime HD (SID: 13). ;(function($) { { } ], } }, ] ] ] { }); LITHIUM.Auth.CHECK_SESSION_TOKEN = 'KwGB64g9UgveIYxc12ycgwO0BAZ39HmfXd9d3czjJx4. Leider werden die genauen Frequenzen mittlerweile nicht mehr auf der offiziellen Webseite von Vodafone West (ehem. } "action" : "rerender" { "action" : "pulsate" }, } "useSimpleView" : "false", ], } }, ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_1bb0e1e206829c","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/289946&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "action" : "rerender" LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" { ] "event" : "AcceptSolutionAction", { "parameters" : { "accessibility" : false, { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } { "action" : "rerender" "actions" : [ count = 0; { } } { { "actions" : [ { { "context" : "envParam:quiltName,message", "event" : "expandMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_1bb0e1e206829c","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_1bb0e1e206829c_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/289946&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_ffwYZ9CApsDyuA2uO8VEKXzvo_PRbdPZL9nIGSfzC0. "action" : "rerender" ], } "actions" : [ "event" : "markAsSpamWithoutRedirect", "action" : "rerender" lithadmin: [] Bist du sicher, dass du fortfahren möchtest? "useCountToKudo" : "false", "actions" : [ logmein: [76, 79, 71, 77, 69, 73, 78], "showCountOnly" : "false", "event" : "unapproveMessage", "kudosLinksDisabled" : "false", }, } "actions" : [ "event" : "deleteMessage", "event" : "AcceptSolutionAction", }, ;(function($) { "event" : "approveMessage", "}); { "actions" : [ { "actions" : [ Bist du sicher, dass du fortfahren möchtest? notifCount = parseInt($(this).html()) + notifCount; ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); ] { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); $(document).ready(function(){ LITHIUM.Cache.CustomEvent.set([{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2282910}},{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2282911}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2282912}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2282913}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2282914}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2282915}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2282916}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492762}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2586002}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493135}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2598721}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2598678}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602373}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602370}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602343}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602312}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602257}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602227}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602213}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602196}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602181}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602097}}]); ] "useCountToKudo" : "false", { "action" : "rerender" } ] "event" : "addMessageUserEmailSubscription", "parameters" : { "action" : "rerender" }, "action" : "rerender" { "event" : "deleteMessage", { "useTruncatedSubject" : "true", ] } } Februar 2007 Beiträge: 70 Zustimmungen: 0 Punkte für Erfolge: 16. } "quiltName" : "ForumMessage", "action" : "rerender" } "disableLinks" : "false", "actions" : [ "context" : "", } "context" : "envParam:selectedMessage", Ich habe Pegelwerte von -40 in der Anzeige der Fritzbox Cable 6490. { "context" : "", { } "action" : "rerender" "action" : "rerender" "action" : "rerender" "event" : "approveMessage", } "action" : "pulsate" "message" : "2282911", "actions" : [ LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; } logmein: [76, 79, 71, 77, 69, 73, 78], } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2282916 .lia-rating-control-passive', '#form_5'); }, "initiatorBinding" : true, ', 'ajax'); } "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl",

Timetex Schulplaner 2020/21, Ständig Genervt Von Allem, Witzelstraße 19 Düsseldorf, Medizinstudium Nach Studium, Herstellungskosten Gebäude Tabelle,